PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G71030.1
Common NameATMYBL2, F23N20.2, MYBL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 195aa    MW: 22098.1 Da    PI: 10.4105
Description MYB-like 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G71030.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.2e-153780348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +++++Ed+l+++++++lG++ W++Ia +++ gRt+++++ +w +yl
      AT1G71030.1 37 NFSKDEDDLILKLHALLGNR-WSLIAGRLP-GRTDNEVRIHWETYL 80
                     79******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.9E-181790IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-41842IPR009057Homeodomain-like
PROSITE profilePS5129424.4683084IPR017930Myb domain
SMARTSM007175.2E-153482IPR001005SANT/Myb domain
PfamPF002491.9E-143780IPR001005SANT/Myb domain
CDDcd001672.68E-123780No hitNo description
Gene3DG3DSA:1.10.10.601.6E-194381IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0001380developmental stagesepals enclosing flower bud stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNKTRLRALS PPSGMQHRKR CRLRGRNYVR PEVKQRNFSK DEDDLILKLH ALLGNRWSLI  60
AGRLPGRTDN EVRIHWETYL KRKLVKMGID PTNHRLHHHT NYISRRHLHS SHKEHETKII  120
SDQSSSVSES CGVTILPIPS TNCSEDSTST GRSHLPDLNI GLIPAVTSLP ALCLQDSSES  180
STNGSTGQET LLLFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-17198443108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.209810.0bud| flower| inflorescence| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306987710.0
Genevisible259751_at0.0
Expression AtlasAT1G71030-
AtGenExpressAT1G71030-
ATTED-IIAT1G71030-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative myb family transcription factor. In contrast to most other myb-like proteins its myb domain consists of a single repeat. A proline-rich region potentially involved in transactivation is found in the C-terminal part of the protein. Its transcript accumulates mainly in leaves.
Function -- GeneRIF ? help Back to Top
  1. AtMYBL2 acts as a transcriptional repressor and negatively regulates the biosynthesis of anthocyanin.
    [PMID: 18532977]
  2. MYBL2 interacts with basic helix-loop-helix proteins to regulate anthocyanin biosynthesis.
    [PMID: 18532978]
  3. MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis.
    [PMID: 23169658]
  4. While BIN2 phosphorylates and destabilizes BES1/BZR1, BIN2 phosphorylated MYBL2 and HAT1 appear to be stabilized.
    [PMID: 24526246]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G71030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G63650 (A), AT3G13540 (A), AT4G09820 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G56650(R), AT1G63650(R), AT1G79840(R), AT4G09820(R), AT5G35550(R), AT5G42800(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G71030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3706090.0AF370609.1 Arabidopsis thaliana putative transcription factor (F23N20.2) mRNA, complete cds.
GenBankAY0482310.0AY048231.1 Arabidopsis thaliana At1g71030/F23N20_2 mRNA, complete cds.
GenBankAY0870930.0AY087093.1 Arabidopsis thaliana clone 31592 mRNA, complete sequence.
GenBankAY0916970.0AY091697.1 Arabidopsis thaliana At1g71030/F23N20_2 mRNA, complete cds.
GenBankAY5195190.0AY519519.1 Arabidopsis thaliana MYB transcription factor (At1g71030) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177259.11e-142putative myb family transcription factor
TrEMBLQ9C9A51e-142Q9C9A5_ARATH; At1g71030/F23N20_2
STRINGAT1G71030.11e-141(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Sawa S
    Overexpression of the AtmybL2 gene represses trichome development in Arabidopsis.
    DNA Res., 2002. 9(2): p. 31-4
    [PMID:12056412]
  3. Wu XM,Lim SH,Yang WC
    Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid.
    Plant Mol. Biol., 2003. 51(6): p. 959-72
    [PMID:12777054]
  4. Vlieghe K, et al.
    Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation.
    J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59
    [PMID:12953064]
  5. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  6. Rizhsky L,Davletova S,Liang H,Mittler R
    The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis.
    J. Biol. Chem., 2004. 279(12): p. 11736-43
    [PMID:14722088]
  7. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  8. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  9. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  10. Cornah JE,Germain V,Ward JL,Beale MH,Smith SM
    Lipid utilization, gluconeogenesis, and seedling growth in Arabidopsis mutants lacking the glyoxylate cycle enzyme malate synthase.
    J. Biol. Chem., 2004. 279(41): p. 42916-23
    [PMID:15272001]
  11. He JX, et al.
    BZR1 is a transcriptional repressor with dual roles in brassinosteroid homeostasis and growth responses.
    Science, 2005. 307(5715): p. 1634-8
    [PMID:15681342]
  12. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  13. Nakamura A, et al.
    Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type.
    Plant J., 2006. 45(2): p. 193-205
    [PMID:16367964]
  14. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  15. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  16. Broekgaarden C, et al.
    Genotypic variation in genome-wide transcription profiles induced by insect feeding: Brassica oleracea--Pieris rapae interactions.
    BMC Genomics, 2007. 8: p. 239
    [PMID:17640338]
  17. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  18. Matsui K,Umemura Y,Ohme-Takagi M
    AtMYBL2, a protein with a single MYB domain, acts as a negative regulator of anthocyanin biosynthesis in Arabidopsis.
    Plant J., 2008. 55(6): p. 954-67
    [PMID:18532977]
  19. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  20. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  21. Agudelo-Romero P, et al.
    Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
    Virol. J., 2008. 5: p. 92
    [PMID:18684336]
  22. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  23. Li SF, et al.
    The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis.
    Plant Cell, 2009. 21(1): p. 72-89
    [PMID:19136646]
  24. Rowan DD, et al.
    Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana.
    New Phytol., 2009. 182(1): p. 102-15
    [PMID:19192188]
  25. Arsovski AA,Villota MM,Rowland O,Subramaniam R,Western TL
    MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(9): p. 2601-12
    [PMID:19401413]
  26. Feyissa DN,Løvdal T,Olsen KM,Slimestad R,Lillo C
    The endogenous GL3, but not EGL3, gene is necessary for anthocyanin accumulation as induced by nitrogen depletion in Arabidopsis rosette stage leaves.
    Planta, 2009. 230(4): p. 747-54
    [PMID:19621239]
  27. Jeong SW, et al.
    Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis.
    Plant Physiol., 2010. 154(3): p. 1514-31
    [PMID:20876338]
  28. Th
    A new system for fast and quantitative analysis of heterologous gene expression in plants.
    New Phytol., 2012. 193(2): p. 504-12
    [PMID:22023451]
  29. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  30. Ye H,Li L,Guo H,Yin Y
    MYBL2 is a substrate of GSK3-like kinase BIN2 and acts as a corepressor of BES1 in brassinosteroid signaling pathway in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(49): p. 20142-7
    [PMID:23169658]
  31. Li S,Zachgo S
    TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana.
    Plant J., 2013. 76(6): p. 901-13
    [PMID:24118612]
  32. Zhang D, et al.
    Transcription factors involved in brassinosteroid repressed gene expression and their regulation by BIN2 kinase.
    Plant Signal Behav, 2014. 9(1): p. e27849
    [PMID:24526246]
  33. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  34. Kirik V,B
    A novel leaf-specific myb-related protein with a single binding repeat.
    Gene, 1996. 183(1-2): p. 109-13
    [PMID:8996094]